PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008230759.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family NAC
Protein Properties Length: 396aa    MW: 44082.2 Da    PI: 6.9962
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008230759.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM166.96.8e-52141411128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     + pGfrFhPtdeelv +yL++k++++ l++ e i++vdiyk++PwdLpk ++++ekewyf+++rd+ky+++ r+nr+t +g+Wkatg+d++++s+
  XP_008230759.1  14 MLPGFRFHPTDEELVGFYLRRKIQQRLLPI-ELIRQVDIYKYDPWDLPKLASTGEKEWYFYCPRDRKYRNSARPNRVTGAGFWKATGTDRPIYSS 107
                     579***************************.89***************9888999***************************************9 PP

             NAM  96 .kgelvglkktLvfykgrapkgektdWvmheyrl 128
                      +++ +glkk+Lvfy+gra kg ktdW+mhe+rl
  XP_008230759.1 108 eGSKCIGLKKSLVFYRGRAAKGIKTDWMMHEFRL 141
                     56677***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.88E-5713173IPR003441NAC domain
PROSITE profilePS5100556.86614173IPR003441NAC domain
PfamPF023651.9E-2516141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009733Biological Processresponse to auxin
GO:0045770Biological Processpositive regulation of asymmetric cell division
GO:0048103Biological Processsomatic stem cell division
GO:0048829Biological Processroot cap development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 396 aa     Download sequence    Send to blast
MDEKNDMDKI DDVMLPGFRF HPTDEELVGF YLRRKIQQRL LPIELIRQVD IYKYDPWDLP  60
KLASTGEKEW YFYCPRDRKY RNSARPNRVT GAGFWKATGT DRPIYSSEGS KCIGLKKSLV  120
FYRGRAAKGI KTDWMMHEFR LPSLSESAAP PKKLLDKSLP ANDAWAICRI FKKTNSMAQR  180
ALSHSWGSPF PEPTAASGLL NQGAHCTQFS SENMSCTTDI GSSIQFWSNN DLQQASNASY  240
SAFDTLPYKP INPTGSKPSI FDADQFPNGF MFSPGEMSGP ISPALIGDLS NATGSIDFDG  300
SQQQQFSGFS INLSQNQMQG NMETGENEGG FRKNLSSSTS HANNNNNNGQ WGSIRPIAFP  360
FSLASDDDAW KPTLPSDSPP CPSDMSTSYS TNKCYS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A4e-521617617171Stress-induced transcription factor NAC1
4dul_B4e-521617619168NAC domain-containing protein 19
4dul_A4e-521617619168NAC domain-containing protein 19
1ut7_B4e-521617619168NO APICAL MERISTEM PROTEIN
1ut7_A4e-521617619168NO APICAL MERISTEM PROTEIN
1ut4_B4e-521617619168NO APICAL MERISTEM PROTEIN
1ut4_A4e-521617619168NO APICAL MERISTEM PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008230759.10.0PREDICTED: protein FEZ
SwissprotQ9ZVH01e-105FEZ_ARATH; Protein FEZ
TrEMBLM5WYS40.0M5WYS4_PRUPE; Uncharacterized protein
STRINGPOPTR_0017s11830.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20133490
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26870.11e-106NAC family protein